counterion raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2026-01-06 and is reviewed periodically as new material appears.
Chromatographic separation resolves truncated, oxidized, deamidated, and epimerized peptide variants when their retention times differ from the target. Mass spectrometry confirms molecular mass and can reveal modifications that UV detection misses. Liquid chromatography coupled to mass spectrometry combines separation with identity information, which helps distinguish a pure target from a co-eluting impurity. UV-based area percent can overestimate purity if an impurity lacks a chromophore or if the target and impurity have similar response factors. Researchers often report both chromatographic purity and mass confirmation to give a fuller picture.
Additional techniques address components that reversed-phase chromatography may not resolve. Ion-exchange chromatography separates by charge, size-exclusion chromatography detects aggregates, and capillary electrophoresis offers high separation efficiency. Water content is measured by Karl Fischer titration, residual solvents by gas chromatography, and elemental impurities by inductively coupled plasma mass spectrometry. Amino acid analysis or nitrogen determination can estimate peptide content on a mass basis. Purity is frequently reported as area percent, yet standardized comparison across laboratories remains an open question because methods and reporting practices differ.
Handling and storage influence measured purity, and peptides can oxidize, deamidate, aggregate, or adsorb to surfaces over time. Lyophilized powders stored at -20 °C or lower are generally more stable than solutions, though some sequences require different conditions. Repeated freeze-thaw cycles can promote aggregation and loss, so testing after storage checks whether purity has changed. Stability-indicating methods compare stressed and unstressed samples to detect degradation pathways. Light exposure and pH can also accelerate modification.
Solid-phase peptide synthesis can produce truncated sequences when coupling reactions fail. Deletion peptides lack one or more internal residues, while truncation peptides end prematurely. Side reactions include aspartimide formation, oxidation of methionine, and aggregation during chain assembly. Crude synthetic peptides therefore contain target peptide plus related impurities, counterions, residual solvents, and water. Purification by preparative chromatography reduces these impurities but does not remove every closely related species, including some that differ by a single amino acid.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilized peptides commonly appear as powders; color can vary with sequence. |
| Solubility class | Variable; often soluble in water or aqueous buffer | Depends on sequence, charge, and hydrophobicity. |
| Typical storage temperature | -20 °C or lower | Desiccated and protected from light; avoid repeated freeze-thaw cycles. |
| Typical analytical method | Reversed-phase HPLC with UV detection | Often paired with mass spectrometry for identity confirmation. |
| Common synonyms | Peptide purity analysis; peptide purity assay | Used in certificate of analysis and quality control contexts. |
Other methods address specific purity concerns. Amino acid analysis gives compositional data after hydrolysis, while capillary electrophoresis separates by charge-to-mass ratio. Karl Fischer titration measures residual water, and gas chromatography can detect residual solvents. Nuclear magnetic resonance can identify organic impurities but is less sensitive for trace levels. No single test covers all possible impurities, so purity testing usually combines orthogonal methods and reports the conditions used. The choice of methods is guided by the impurity classes of interest.
Reverse-phase high-performance liquid chromatography (RP-HPLC) is widely used to estimate peptide purity. It separates components by hydrophobicity on a column with a water-organic mobile phase. Ultraviolet absorbance at 214 nm or 220 nm detects peptide bonds. The main peak area as a percentage of total peak area gives a purity figure. This figure depends on column, gradient, wavelength, and how peaks are integrated, so it is method-specific rather than absolute.
Interpreting chromatographic purity requires attention to detection limits and response factors. Peptides without aromatic residues may absorb weakly at 280 nm, so 214 nm is often preferred, but mobile-phase additives and solvents also absorb at low wavelengths. Co-eluting impurities with different molar absorptivities can produce area percentages that differ from mass percentages. Integration parameters, peak tailing, and baseline choice further affect reported values. For these reasons, method details belong alongside any purity figure, and orthogonal methods are needed to confirm identity and impurity profiles.
Reverse-phase high-performance liquid chromatography is the most common primary method for peptide purity testing. The peptide mixture passes through a hydrophobic stationary phase, and components elute according to differences in hydrophobicity. A mobile phase of water and acetonitrile, often with trifluoroacetic acid as an ion-pairing agent, improves peak shape and retention. Ultraviolet detection at 214 nm records the peptide backbone absorbance, and the main peak area is divided by the total peak area to give an area-percent purity value.
Other chromatographic modes provide complementary information that reverse-phase separation may not capture. Ion-exchange chromatography separates peptides by net charge and can resolve deamidated, oxidized, or truncated variants that co-elute under hydrophobic conditions. Size-exclusion chromatography detects aggregates and higher-order oligomers, which are often invisible in reverse-phase assays. Chiral chromatography can quantify D-amino acid epimers when stereochemical purity matters. Because each mode uses a different separation principle, a single purity number from one method cannot describe all possible impurities.
Storage and handling conditions affect both peptide stability and the accuracy of later purity tests. Lyophilized powders are commonly kept desiccated at -20 °C or below, while reconstituted solutions require a defined buffer, pH, and temperature range. Repeated freeze-thaw cycles can promote aggregation, oxidation, or hydrolysis over time. Each cycle may alter the chromatogram and complicate comparison with earlier results. Stability data, when available, should guide handling intervals and solvent choice.
Independent verification is used when a supplier result needs confirmation or when a material supports regulated work. A second laboratory can repeat reverse-phase HPLC and mass spectrometry on the same sample. Discrepancies may arise from different columns, gradients, detection wavelengths, or sample preparation. Moisture uptake and counterion content can lower net peptide mass without changing area percent. Documentation of methods and raw data helps distinguish analytical variation from a true quality difference.
Quality control for peptides begins with a documented specification that states the required purity, identity, and appearance. Suppliers often release research-grade material at 95% or greater by HPLC area, but this threshold is not universal. A certificate of analysis typically records the lot number, sequence, test methods, and measured values. The document allows a user to compare batches and to trace deviations. Specifications should match the intended use rather than a generic label.
A typical intracellular concentration of ATP is 1–10 μmol per gram of muscle tissue in a variety of eukaryotes. The dephosphorylation of ATP and rephosphorylation of ADP and AMP occur repeatedly in the course of aerobic metabolism. ATP can be produced by a number of distinct cellular processes; the three main pathways in eukaryotes are (1) glycolysis, (2) the citric acid cycle/oxidative phosphorylation, and (3) beta-oxidation. The overall process of oxidizing glucose to carbon dioxide, the combination of pathways 1 and 2, known as cellular respiration, produces about 30 equivalents of ATP from each molecule of glucose. ATP production by a non-photosynthetic aerobic eukaryote occurs mainly in the mitochondria, which comprise nearly 25% of the volume of a typical cell.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The only drug currently approved for stroke treatment is tPA, which can cause dangerous brain bleeding. In 2005, Griffin et al proposed using Activated Protein C in conjunction with tPA to protect the brain from tPA’s harmful side-effects. APC activates protease-activated receptor 1 (PAR-1), which plays a role in the interaction of coagulation and inflammation. The 3K3A-APC was designed to have more activity at protease-activated receptor 1 (PAR-1) and less anticoagulative effect than activated protein C. The phase 2 trial, RHAPSODY, was performed in the lab of Berislav Zlokovic, the scientific founder of ZZ Biotech, to determine safety and tolerability of the drug. A phase 3 $30 million trial, RHAPSODY-2, was planned to determine safety and efficacy for treatment of ischemic stroke. However, on November 16, 2023, the National Institutes of Health (NIH) paused the start of the human trial of 3K3A-APC after an investigation by Science Magazine.
The use of high-resolution ion-mobility mass spectrometry (IMS-MS) on HPLC-purified alpha-synuclein in vitro has shown alpha-synuclein to be autoproteolytic (self-proteolytic), generating a variety of small molecular weight fragments upon incubation. The 14.46 kDa protein was found to generate numerous smaller fragments, including 12.16 kDa (amino acids 14–133) and 10.44 kDa (40–140) fragments formed through C- and N-terminal truncation and a 7.27 kDa C-terminal fragment (72–140). The 7.27 kDa fragment, which contains the majority of the NAC region, aggregated considerably faster than full-length alpha-synuclein. It is possible that these autoproteolytic products play a role as intermediates or cofactors in the aggregation of alpha-synuclein in vivo.
Another strategy for site-specific amine conjugation to proteins is to replace lysine residues with arginine residues (LDVs). If all lysines are depleted then the only remaining free amine is at the amino terminus (N-terminus) of the protein. In the case where the protein is an antibody Fc domain, a recombinant LDV Fc can still be purified using protein A. LDV Fc proteins fused with short peptide targeting sequences can be used to deliver conjugated payloads, including nanoparticles, to specific cell surface proteins. The majority of ADCs under development or in clinical trials are for oncological and hematological indications. This is primarily driven by the inventory of monoclonal antibodies, which target various types of cancer. However, some developers are looking to expand the application to other important disease areas.
Sources: en.wikipedia.org
Righthanded β-helices, typified by the pectate lyase enzyme shown at left or P22 phage tailspike protein, have a less regular cross-section, longer and indented on one of the sides; of the three linker loops, one is consistently just two residues long and the others are variable, often elaborated to form a binding or active site. A two-sided β-helix (right-handed) is found in some bacterial metalloproteases; its two loops are each six residues long and bind stabilizing calcium ions to maintain the integrity of the structure, using the backbone and the Asp side chain oxygens of a GGXGXD sequence motif. This fold is called a β-roll in the SCOP classification.
The 2014 Ebola outbreak killed more than 11,300 people. In the Democratic Republic of Congo (DRC), as of January 2020, this is the second largest outbreak with over 3,400 confirmed or probable cases, including more than 2,200 deaths. Regeneron used its VelociGene, VelocImmune, and VelociMab antibody discovery and production technologies and coordinated with the U.S. government's Biomedical Advanced Research and Development Authority (BARDA). The therapy was developed in 6 months and a Phase 1 trial in healthy humans was completed in 2015.
The predecessor to the CAD, termed an evaporative electrical detector, was first described by Kaufman in 2002 at TSI Inc in US patent 6,568,245 and was based on the coupling of liquid chromatographic approaches to TSI's electrical aerosol measurement (EAM) technology. At around the same time Dixon and Peterson at California State University were investigating the coupling of liquid chromatography to an earlier version of TSI's EAM technology, which they called an aerosol charge detector. Subsequent collaboration between TSI and ESA Biosciences Inc. (now part of Thermo Fisher Scientific), led to the first commercial instrument, the Corona CAD, which received both the Pittsburgh Conference Silver Pittcon Editor's Award (2005) and R&D 100 award (2005). Continued research and engineering improvements in product design resulted in CADs with ever increasing capabilities. The newest iterations of the CAD are the Thermo Scientific Corona Veo Charged Aerosol Detector, Corona Veo RS Charged Aerosol Detector and Thermo Scientific Vanquish Charged Aerosol Detectors.
5-HTP has been used medically and as a supplement under the name oxitriptan in the treatment of depression and for certain other indications. As of 2025, there are no current FDA approved medications containing 5-HTP. It can be potentiated in combination with a peripherally selective aromatic L-amino acid decarboxylase (AAAD) inhibitor such as carbidopa or benserazide. These agents increase the strength and duration of oxitriptan. An investigational combination formulation is oxitriptan/carbidopa.
In many organisms including Xenopus and Drosophila, the midblastula transition usually occurs after a particular number of cell divisions for a given species, and is defined by the ending of the synchronous cell division cycles of the early blastula development, and the lengthening of the cell cycles by the addition of the G1 and G2 phases. Prior to this transition, cleavage occurs with only the synthesis and mitosis phases of the cell cycle. The addition of the two growth phases into the cell cycle allows for the cells to increase in size, as up to this point the blastomeres undergo reductive divisions in which the overall size of the embryo does not increase, but more cells are created. This transition begins the growth in size of the organism. The mid-blastula transition is also characterized by a marked increase in transcription of new, non-maternal mRNA transcribed from the genome of the organism. Large amounts of the maternal mRNA are destroyed at this point, either by proteins such as SMAUG in Drosophila or by microRNA. These two processes shift the control of the embryo from the maternal mRNA to the nuclei.
Sources: en.wikipedia.org
It usually refers to the relative peak area of the target peptide in a chromatogram, not the mass fraction of the entire sample. Different analytical methods can yield different purity values. Water, counterions, and residual solvents are excluded unless the calculation specifies otherwise.
A single method can miss co-eluting impurities, salts, water, or structural modifications. Orthogonal techniques separate compounds by different properties, such as hydrophobicity, charge, or size. Combining results gives a more complete assessment of sample composition.
No, purity measures the amount of target relative to other peaks, not the identity or sequence of the target. Mass spectrometry and sequencing may be needed to confirm structure. A high-purity sample can still contain a peptide with an incorrect sequence.
No. Purity testing measures chemical composition and does not assess biological activity, sterility, or endotoxin levels. Functional performance must be tested in the intended assay.